PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P11600_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 276aa    MW: 31647.3 Da    PI: 6.5108
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P11600_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-1875128356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++t eq+++Le+ Fe  +++  e++ +LA+ lg++ rqV +WFqNrRa++k
  GSMUA_Achr7P11600_001  75 KKRRLTVEQVRTLEKNFELGNKLEPERKMQLARTLGMQPRQVAIWFQNRRARWK 128
                            45689************************************************9 PP

2HD-ZIP_I/II131.24e-4274166193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lg+qprqva+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+ene+L++++++L+
  GSMUA_Achr7P11600_001  74 EKKRRLTVEQVRTLEKNFELGNKLEPERKMQLARTLGMQPRQVAIWFQNRRARWKTKQLEKDYDVLKRHFEAIKSENEALKAHNNQLQ 161
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            +e+++
  GSMUA_Achr7P11600_001 162 AEIMT 166
                            99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-2065132IPR009057Homeodomain-like
PROSITE profilePS5007117.4170130IPR001356Homeobox domain
SMARTSM003895.4E-1873134IPR001356Homeobox domain
PfamPF000469.6E-1675128IPR001356Homeobox domain
CDDcd000867.12E-1675131No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1977137IPR009057Homeodomain-like
PRINTSPR000311.8E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000311.8E-5110126IPR000047Helix-turn-helix motif
PfamPF021831.7E-16130170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MASSFFHHGF MLQMQTPHEE EHQLLTPSPC TNLQDLRGTA SMVGKRSVSF SGMDTCREMS  60
AEEDLSDDGS QAGEKKRRLT VEQVRTLEKN FELGNKLEPE RKMQLARTLG MQPRQVAIWF  120
QNRRARWKTK QLEKDYDVLK RHFEAIKSEN EALKAHNNQL QAEIMTLRGR EPSDLINLNK  180
DTEGSCSNRS ENSSEINLDI SRQSVDKSPL HPHQSSTFFQ PVRPGDMDQI FQSSSRPETQ  240
CPKLENGGHE GTLSNLLCSM EDQSAFWSWS DHHSFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6205224e-88JX620522.1 Gossypium hirsutum clone NBRI_GE66779 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409146.10.0PREDICTED: homeobox-leucine zipper protein HOX21-like
SwissprotQ8S7W99e-94HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLM0TGP80.0M0TGP8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P11600_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-93HD-ZIP family protein